FGFR3 (NM_000142) Human Recombinant Protein
CAT#: TP315533
Recombinant protein of human fibroblast growth factor receptor 3 (FGFR3), transcript variant 1, 20 µg
View other "FGFR3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215533 representing NM_000142
Red=Cloning site Green=Tags(s) MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMG PTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDE AEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQ WSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSD AQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHH SAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAE AIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAK GNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNV MKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPV EELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQY SPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT TRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 85.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000133 |
Locus ID | 2261 |
UniProt ID | P22607 |
Refseq Size | 4093 |
Cytogenetics | 4p16.3 |
Refseq ORF | 2418 |
Synonyms | ACH; CD333; CEK2; HSFGFR3EX; JTK4 |
Summary | This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Bladder cancer, Endocytosis, MAPK signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424902 | FGFR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY424902 | Transient overexpression lysate of fibroblast growth factor receptor 3 (FGFR3), transcript variant 1 |
CNY 4,840.00 |
|
PH315533 | FGFR3 MS Standard C13 and N15-labeled recombinant protein (NP_000133) |
CNY 19,520.00 |
|
TP700122 | Purified recombinant protein of human fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism)(FGFR3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP700123 | Purified recombinant protein FGFR3 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens fibroblast growth factor receptor 3, transcript variant 2, Signal peptide (1-22) plus EC domain (23-310) expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP700124 | Purified recombinant protein of human fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism)(FGFR3), transcript variant 3, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP710033 | Recombinant protein of human fibroblast growth factor receptor 3 (FGFR3), residues 23-375, with C-terminal DDK tag, expressed in sf9 cells. |
CNY 4,020.00 |