United States
Germany
Japan
United Kingdom
China
Dystrophin (DMD) (NM_004018) Human Recombinant Protein
CAT＃: TP315529
Recombinant protein of human dystrophin (DMD), transcript variant Dp71ab, 20 µg
View other "Dystrophin" proteins (16)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215529 representing NM_004018
Red=Cloning site Green=Tags(s) MREQLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNL KQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCK AHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEA ALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAK GHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPASSPQLSHD DTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESE ERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGR LEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMG EEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGHNVGSLFHMADDLGRAMESLVSVMTDEEGAE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 70.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004009 |
| Locus ID | 1756 |
| UniProt ID | P11532 |
| Refseq Size | 4552 |
| Cytogenetics | Xp21.2-p21.1 |
| Refseq ORF | 1866 |
| Synonyms | BMD; CMD3B; DXS142; DXS164; DXS206; DXS230; DXS239; DXS268; DXS269; DXS270; DXS272; MRX85 |
| Summary | This gene spans a genomic range of greater than 2 Mb and encodes a large protein containing an N-terminal actin-binding domain and multiple spectrin repeats. The encoded protein forms a component of the dystrophin-glycoprotein complex (DGC), which bridges the inner cytoskeleton and the extracellular matrix. Deletions, duplications, and point mutations at this gene locus may cause Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), or cardiomyopathy. Alternative promoter usage and alternative splicing result in numerous distinct transcript variants and protein isoforms for this gene. [provided by RefSeq, Dec 2016] |
| Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418275 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC418276 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC418277 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC418278 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC418279 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418281 | DMD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY418275 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71 |
CNY 4,840.00 |
|
| LY418276 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71b |
CNY 4,840.00 |
|
| LY418277 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71a |
CNY 4,840.00 |
|
| LY418278 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71ab |
CNY 4,840.00 |
|
| LY418279 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp40 |
CNY 3,080.00 |
|
| LY418281 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp140b |
CNY 4,840.00 |
|
| PH313926 | DMD MS Standard C13 and N15-labeled recombinant protein (NP_004012) |
CNY 19,520.00 |
|
| PH315529 | DMD MS Standard C13 and N15-labeled recombinant protein (NP_004009) |
CNY 19,520.00 |
|
| TP313926 | Recombinant protein of human dystrophin (DMD), transcript variant Dp140b, 20 µg |
CNY 2,900.00 |
|
| TP762385 | Purified recombinant protein of Human dystrophin (DMD), transcript variant Dp427m, Lys3200-Thr3684, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
其它Dystrophin产品
