STK23 (SRPK3) (NM_014370) Human Recombinant Protein

CAT#: TP315496

Recombinant protein of human SFRS protein kinase 3 (SRPK3), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "STK23" proteins (5)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 2,900.00

CN¥ 6,650.00


货期*
现货

规格
    • 20 ug

Product images

经常一起买 (2)
SRPK3 mouse monoclonal antibody,clone OTI6F5
    • 100 ul

CN¥ 1,999.00
CN¥ 2,700.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC215496 protein sequence
Red=Cloning site Green=Tags(s)

MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGSDDEEQEDPKDYCKGGYHPVK
IGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKR
ETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIH
TDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKR
LLEERLRDLQRLEAMEAATQAEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQT
SGFSGSLFSPASCSILSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHF
TEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPP
AFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCL
QHPWLNP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 61.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Bioactivity SRPK3 activity verified in a biochemical assay: SRPK3 (SRSF protein kinase 3) (TP315496) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. SRPK3 is a serine/threonine kinase similar to a protein kinase which is specific for the SR (serine/arginine-rich domain) family of splicing factors. Varying concentrations of SRPK3 were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors.
Reference Data
RefSeq NP_055185
Locus ID 26576
UniProt ID Q9UPE1
Refseq Size 2014
Cytogenetics Xq28
Refseq ORF 1701
Synonyms MSSK-1; MSSK1; STK23
Summary This gene encodes a protein kinase similar to a protein kinase which is specific for the SR (serine/arginine-rich domain) family of splicing factors. A highly similar protein has been shown to play a role in muscle development in mice. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]
Protein Families Druggable Genome, Protein Kinase
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...