RYK (NM_001005861) Human Recombinant Protein
CAT#: TP315449
Recombinant protein of human RYK receptor-like tyrosine kinase (RYK), transcript variant 1, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215449 representing NM_001005861
Red=Cloning site Green=Tags(s) MRGAARLGRPGRSCLPGARGLRAPPPPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASAGPSVSLYLSE DEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNI SVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNT SRTIYDPVHAAPTTSTRVFYISVGVCCAVIFLVAIILAVLHLHSMKRIELDDSISASSSSQGLSQPSTQT TQYLRADTPNNATPITSSLGYPTLRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHG ILIDEKDPNKEKQAFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEKPMVILPYMNWG NLKLFLRQCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALS RDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPFEMAAYLKD GYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALGAYV SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 67.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001005861 |
Locus ID | 6259 |
UniProt ID | P34925 |
Refseq Size | 2960 |
Cytogenetics | 3q22.2 |
Refseq ORF | 1830 |
Synonyms | D3S3195; JTK5; JTK5A; RYK1 |
Summary | The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. The encoded protein has a leucine-rich extracellular domain with a WIF-type Wnt binding region, a single transmembrane domain, and an intracellular tyrosine kinase domain. This protein is involved in stimulating Wnt signaling pathways such as the regulation of axon pathfinding. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418988 | RYK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC423665 | RYK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC425156 | RYK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418988 | Transient overexpression lysate of RYK receptor-like tyrosine kinase (RYK), transcript variant 2 |
CNY 4,840.00 |
|
LY423665 | Transient overexpression lysate of RYK receptor-like tyrosine kinase (RYK), transcript variant 1 |
CNY 4,840.00 |
|
PH315449 | RYK MS Standard C13 and N15-labeled recombinant protein (NP_001005861) |
CNY 19,520.00 |
|
PH315509 | RYK MS Standard C13 and N15-labeled recombinant protein (NP_002949) |
CNY 19,520.00 |
|
TP315509 | Recombinant protein of human RYK receptor-like tyrosine kinase (RYK), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP700167 | Purified recombinant protein of human receptor-like tyrosine kinase (RYK), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |