Gastrin Releasing Peptide (GRP) (NM_001012513) Human Recombinant Protein
CAT#: TP315122
Purified recombinant protein of Homo sapiens gastrin-releasing peptide (GRP), transcript variant 3, 20 µg
View other "Gastrin Releasing Peptide" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215122 representing NM_001012513
Red=Cloning site Green=Tags(s) MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQ LREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDLVDSLLQVLNVKEGTPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001012531 |
Locus ID | 2922 |
UniProt ID | P07492 |
Refseq Size | 844 |
Cytogenetics | 18q21.32 |
Refseq ORF | 414 |
Synonyms | BN; GRP-10; preproGRP; proGRP |
Summary | This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419540 | GRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422879 | GRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419540 | Transient overexpression lysate of gastrin-releasing peptide (GRP), transcript variant 1 |
CNY 3,080.00 |
|
LY422879 | Transient overexpression lysate of gastrin-releasing peptide (GRP), transcript variant 3 |
CNY 3,080.00 |
|
PH315122 | GRP MS Standard C13 and N15-labeled recombinant protein (NP_001012531) |
CNY 14,250.00 |
|
TP790060 | Purified recombinant protein of Human gastrin-releasing peptide (GRP), isoform 3, residues Gly31-Pro98, with N-terminal HIS-ABP tag, expressed in E.coli, 100 ug |
CNY 1,940.00 |
其它Gastrin Releasing Peptide产品