EIF4H (NM_022170) Human Recombinant Protein
CAT#: TP314822
Recombinant protein of human eukaryotic translation initiation factor 4H (EIF4H), transcript variant 1, 20 µg
View other "EIF4H" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214822 representing NM_022170
Red=Cloning site Green=Tags(s) MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSV RLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGS SRESRGGWDSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPR LQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071496 |
Locus ID | 7458 |
UniProt ID | Q15056 |
Refseq Size | 2546 |
Cytogenetics | 7q11.23 |
Refseq ORF | 744 |
Synonyms | eIF-4H; WBSCR1; WSCR1 |
Summary | This gene encodes one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410402 | EIF4H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410402 | Transient overexpression lysate of eukaryotic translation initiation factor 4H (EIF4H), transcript variant 2 |
CNY 3,080.00 |
|
PH304028 | EIF4H MS Standard C13 and N15-labeled recombinant protein (NP_114381) |
CNY 19,520.00 |
|
PH314822 | EIF4H MS Standard C13 and N15-labeled recombinant protein (NP_071496) |
CNY 19,520.00 |
|
TP304028 | Recombinant protein of human eukaryotic translation initiation factor 4H (EIF4H), transcript variant 2, 20 µg |
CNY 2,900.00 |