EIF4H (NM_031992) Human Mass Spec Standard
CAT#: PH304028
EIF4H MS Standard C13 and N15-labeled recombinant protein (NP_114381)
View other "EIF4H" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | EIF4H MS Standard C13 and N15-labeled recombinant protein (NP_114381) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204028 |
Predicted MW | 25.2 kDa |
Protein Sequence |
>RC204028 protein sequence
Red=Cloning site Green=Tags(s) MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSV RLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGFRD DFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNS AIFGGARPREEVVQKEQE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_114381 |
RefSeq Size | 2486 |
RefSeq ORF | 684 |
Synonyms | eIF-4H; WBSCR1; WSCR1 |
Locus ID | 7458 |
Cytogenetics | 7q11.23 |
Summary | This gene encodes one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410402 | EIF4H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410402 | Transient overexpression lysate of eukaryotic translation initiation factor 4H (EIF4H), transcript variant 2 |
CNY 3,080.00 |
|
PH314822 | EIF4H MS Standard C13 and N15-labeled recombinant protein (NP_071496) |
CNY 19,520.00 |
|
TP304028 | Recombinant protein of human eukaryotic translation initiation factor 4H (EIF4H), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP314822 | Recombinant protein of human eukaryotic translation initiation factor 4H (EIF4H), transcript variant 1, 20 µg |
CNY 2,900.00 |