United States
Germany
Japan
United Kingdom
China
CABYR (NM_012189) Human Recombinant Protein
CAT＃: TP314772
Recombinant protein of human calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 1, 20 µg
View other "CABYR" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214772 representing NM_012189
Red=Cloning site Green=Tags(s) MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKW SEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGL SSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLGKVSSIHSDQSDVLMVDVATSMPVVIKEVP SSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVT LQADIEVMSTVHISSVYNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEK TTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLE VEITSIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEIEPEGES TAE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 52.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036321 |
| Locus ID | 26256 |
| UniProt ID | O75952 |
| Refseq Size | 2333 |
| Cytogenetics | 18q11.2 |
| Refseq ORF | 1479 |
| Synonyms | CABYRa; CABYRc; CABYRc/d; CABYRe; CBP86; CT88; FSP-2; FSP2 |
| Summary | To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq, Jul 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406955 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC406956 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406957 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408542 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408543 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415918 | CABYR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY406955 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 2 |
CNY 4,840.00 |
|
| LY406956 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 7 |
CNY 3,080.00 |
|
| LY406957 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 6 |
CNY 3,080.00 |
|
| LY408542 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 5 |
CNY 3,080.00 |
|
| LY408543 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 3 |
CNY 3,080.00 |
|
| LY415918 | Transient overexpression lysate of calcium binding tyrosine-(Y)-phosphorylation regulated (CABYR), transcript variant 1 |
CNY 4,840.00 |
|
| PH314772 | CABYR MS Standard C13 and N15-labeled recombinant protein (NP_036321) |
CNY 19,520.00 |
