RING finger protein unkempt like (UNKL) (NM_001037125) Human Recombinant Protein
CAT#: TP314684
Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 2, 20 µg
View other "RING finger protein unkempt like" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214684 representing NM_001037125
Red=Cloning site Green=Tags(s) MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRD GTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAF AHGPLDLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQDANFVLGSYKT EQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYSWQLGRRVLRLSPRANNPRVALPRVHTGPSSTA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001032202 |
Locus ID | 64718 |
UniProt ID | Q9H9P5 |
Refseq Size | 1401 |
Cytogenetics | 16p13.3 |
Refseq ORF | 831 |
Synonyms | C16orf28; ZC3H5L; ZC3HDC5L |
Summary | This gene encodes a RING finger protein that may function in Rac signaling. It can bind to Brg/Brm-associated factor 60b and can promote its ubiquitination. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422146 | UNKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434369 | UNKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY422146 | Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 2 |
CNY 3,080.00 |
|
LY434369 | Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 1 |
CNY 4,840.00 |
|
PH314684 | UNKL MS Standard C13 and N15-labeled recombinant protein (NP_001032202) |
CNY 14,250.00 |
|
TP301609 | Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它RING finger protein unkempt like产品