HMGA2 (NM_003484) Human Recombinant Protein
CAT#: TP314681
Recombinant protein of human high mobility group AT-hook 2 (HMGA2), transcript variant 2, 20 µg
View other "HMGA2" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214681 representing NM_003484
Red=Cloning site Green=Tags(s) MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEA TGEKRPRGRPRKWDNLLPRTSSKKKTSLGNSTKRSH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003475 |
Locus ID | 8091 |
UniProt ID | P52926 |
Refseq Size | 1539 |
Cytogenetics | 12q14.3 |
Refseq ORF | 318 |
Synonyms | BABL; HMGI-C; HMGIC; LIPO; SRS5; STQTL9 |
Summary | This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401189 | HMGA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC418572 | HMGA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC429148 | HMGA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401189 | Transient overexpression lysate of high mobility group AT-hook 2 (HMGA2), transcript variant 1 |
CN¥ 3,080.00 |
|
LY418572 | Transient overexpression lysate of high mobility group AT-hook 2 (HMGA2), transcript variant 2 |
CN¥ 3,080.00 |
|
LY429148 | Transient overexpression lysate of high mobility group AT-hook 2 (HMGA2), transcript variant 2 |
CN¥ 3,080.00 |
|
PH314681 | HMGA2 MS Standard C13 and N15-labeled recombinant protein (NP_003475) |
CN¥ 19,520.00 |
|
TP761999 | Purified recombinant protein of Human high mobility group AT-hook 2 (HMGA2), transcript variant 1,full length, with N-terminal His-Trx tag, expressed in E. coli, 50ug |
CN¥ 2,050.00 |