NTH1 (NTHL1) (NM_002528) Human Recombinant Protein
CAT#: TP314598
Recombinant protein of human nth endonuclease III-like 1 (E. coli) (NTHL1), 20 µg
View other "NTH1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214598 representing NM_002528
Red=Cloning site Green=Tags(s) MCSPQESGMTALSARMLTRSRSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEG SDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS QTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAE LVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEING LLVGFGQQTCLPVHPRCHACLNQALCPAAQGL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002519 |
Locus ID | 4913 |
UniProt ID | P78549 |
Refseq Size | 1097 |
Cytogenetics | 16p13.3 |
Refseq ORF | 936 |
Synonyms | FAP3; hNTH1; NTH1; OCTS3 |
Summary | The protein encoded by this gene is a DNA N-glycosylase of the endonuclease III family. Like a similar protein in E. coli, the encoded protein has DNA glycosylase activity on DNA substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Base excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419272 | NTHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419272 | Transient overexpression lysate of nth endonuclease III-like 1 (E. coli) (NTHL1) |
CN¥ 3,080.00 |
|
PH314598 | NTHL1 MS Standard C13 and N15-labeled recombinant protein (NP_002519) |
CN¥ 14,250.00 |
|
TP760833 | Purified recombinant protein of Human nth endonuclease III-like 1 (E. coli) (NTHL1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CN¥ 2,040.00 |