NPL (NM_030769) Human Recombinant Protein
CAT#: TP314546
Recombinant protein of human N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) (NPL), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214546 protein sequence
Red=Cloning site Green=Tags(s) MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEW VTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPF YYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVM GATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGP PRLPLQKASREFTDSAEAKLKSLDFLSFTDLKDGNLEAGS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_110396 |
Locus ID | 80896 |
UniProt ID | Q9BXD5 |
Refseq Size | 2867 |
Cytogenetics | 1q25.3 |
Refseq ORF | 960 |
Synonyms | C1orf13; C112; NAL; NPL1 |
Summary | This gene encodes a member of the N-acetylneuraminate lyase sub-family of (beta/alpha)(8)-barrel enzymes. N-acetylneuraminate lyases regulate cellular concentrations of N-acetyl-neuraminic acid (sialic acid) by mediating the reversible conversion of sialic acid into N-acetylmannosamine and pyruvate. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410719 | NPL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410719 | Transient overexpression lysate of N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) (NPL) |
CNY 3,080.00 |
|
PH314546 | NPL MS Standard C13 and N15-labeled recombinant protein (NP_110396) |
CNY 19,520.00 |