RBP1 (NM_002899) Human Recombinant Protein
CAT#: TP314515
Recombinant protein of human retinol binding protein 1, cellular (RBP1), transcript variant 1, 20 µg
View other "RBP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214515 representing NM_002899
Red=Cloning site Green=Tags(s) MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKE FEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme activity regulator (PMID: 25502770) |
Reference Data | |
RefSeq | NP_002890 |
Locus ID | 5947 |
UniProt ID | P09455 |
Refseq Size | 720 |
Cytogenetics | 3q23 |
Refseq ORF | 405 |
Synonyms | CRABP-I; CRBP; CRBP1; CRBPI; RBPC |
Summary | This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Identification of a novel natriuretic protein in patients with cerebral-renal salt wasting - implications for enhanced diagnosis
,Maesaka, J;Imbriano, L;Pinkhasov, A;Muralidharan, R;Song, X;Russo, L;Comper, W;,
The American Journal of the Medical Sciences
[RBP1]
|
Importance of ALDH1A enzymes in determining human testicular retinoic acid concentrations
,Arnold, SL;Kent, T;Hogarth, CA;Schlatt, S;Prasad, B;Haenisch, M;Walsh, T;Muller, CH;Griswold, MD;Amory, JK;Isoherranen, N;,
J. Lipid Res.
,PubMed ID 25502770
[RBP1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401017 | RBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401017 | Transient overexpression lysate of retinol binding protein 1, cellular (RBP1), transcript variant 1 |
CNY 3,080.00 |
|
PH314515 | RBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002890) |
CNY 19,520.00 |