PGP (NM_001042371) Human Recombinant Protein
CAT#: TP314470
Recombinant protein of human phosphoglycolate phosphatase (PGP), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214470 representing NM_001042371
Red=Cloning site Green=Tags(s) MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNS SKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPKAYVLGSPALAAELEAVGVAS VGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGR FIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTL TGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIADLLPALQG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035830 |
Locus ID | 283871 |
UniProt ID | A6NDG6 |
Refseq Size | 1041 |
Cytogenetics | 16p13.3 |
Refseq ORF | 963 |
Synonyms | AUM; G3PP; PGPase |
Summary | Glycerol-3-phosphate phosphatase hydrolyzing glycerol-3-phosphate into glycerol. Thereby, regulates the cellular levels of glycerol-3-phosphate a metabolic intermediate of glucose, lipid and energy metabolism. Was also shown to have a 2-phosphoglycolate phosphatase activity and a tyrosine-protein phosphatase activity. However, their physiological relevance is unclear (PubMed:26755581). In vitro, has also a phosphatase activity toward ADP, ATP, GDP and GTP (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420860 | PGP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420860 | Transient overexpression lysate of phosphoglycolate phosphatase (PGP) |
CNY 3,080.00 |
|
PH314470 | PGP MS Standard C13 and N15-labeled recombinant protein (NP_001035830) |
CNY 14,250.00 |