DUSP27 (DUPD1) (NM_001003892) Human Recombinant Protein

CAT#: TP314361L

Recombinant protein of human dual specificity phosphatase and pro isomerase domain containing 1 (DUPD1), 1 mg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 36,000.00


货期*
4周

规格
    • 1 mg

Product images

经常一起买 (3)
DUPD1 (DUSP27) mouse monoclonal antibody, clone OTI7E4 (formerly 7E4)
    • 100 ul

CN¥ 1,999.00
CN¥ 2,700.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CN¥ 1,050.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC214361 representing NM_001003892
Red=Cloning site Green=Tags(s)

MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATA
LDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDH
SKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQ
DGEEEDGREL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001003892
Locus ID 338599
UniProt ID Q68J44
Refseq Size 663
Cytogenetics 10q22.2
Refseq ORF 660
Synonyms DUPD1; DUSP27; FMDSP
Summary Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues, with a preference for phosphotyrosine as a substrate.[UniProtKB/Swiss-Prot Function]
Protein Families Phosphatase
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...