Nesprin 2 (SYNE2) (NM_182910) Human Recombinant Protein
CAT#: TP313843
Recombinant protein of human spectrin repeat containing, nuclear envelope 2 (SYNE2), transcript variant 2, 20 µg
View other "Nesprin 2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213843 representing NM_182910
Red=Cloning site Green=Tags(s) MEGDRNVPPVPPASSTPYKPPYGKLLLPPGTDGGKEGPRVLNGNPQQEDGGLAGITEQQSGAFDRWEMIQ AQELHNKLKIKQNLQQLNSDISAITTWLKKTEAELEMLKMAKPPSDIQEIELRVKRLQEILKAFDTYKAL VVSVNVSSKEFLQTESPESTELQSRLRQLSLLWEAAQGAVDSWRGGLRQSLMQCQGSKTRPRSDVLFFKD FHQLSQNLLLWLASAKNRRQKAHVTDPKADPRALLECRRELMQLEKELVERQPQVDMLQEISNSLLIKGH GEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRAKFRAVR TTEGEEETESRVPGSTRPQRSFLSRVVRAALPLQLLLLLLLLLACLLPSSEEDYSCTQANNFARSFYPML RYTNGPPPT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_878914 |
Locus ID | 23224 |
UniProt ID | Q8WXH0 |
Refseq Size | 3103 |
Cytogenetics | 14q23.2 |
Refseq ORF | 1287 |
Synonyms | EDMD5; KASH2; Nesp2; Nesprin-2; NUA; NUANCE; SYNE-2; TROPH |
Summary | The protein encoded by this gene is a nuclear outer membrane protein that binds cytoplasmic F-actin. This binding tethers the nucleus to the cytoskeleton and aids in the maintenance of the structural integrity of the nucleus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405324 | SYNE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY405324 | Transient overexpression lysate of spectrin repeat containing, nuclear envelope 2 (SYNE2), transcript variant 2 |
CNY 4,840.00 |
|
PH313843 | SYNE2 MS Standard C13 and N15-labeled recombinant protein (NP_878914) |
CNY 14,250.00 |
其它Nesprin 2产品