Glycerol kinase (GK) (NM_000167) Human Recombinant Protein
CAT#: TP313688
Recombinant protein of human glycerol kinase (GK), transcript variant 2, 20 µg
View other "Glycerol kinase" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213688 representing NM_000167
Red=Cloning site Green=Tags(s) MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEK TCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSK TGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNI HSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYG TGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAK EVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS HLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQ INAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000158 |
Locus ID | 2710 |
UniProt ID | P32189, B4DH54 |
Refseq Size | 3573 |
Cytogenetics | Xp21.2 |
Refseq ORF | 1572 |
Synonyms | GK1; GKD |
Summary | The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerolipid metabolism, Metabolic pathways, PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404332 | GK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424888 | GK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404332 | Transient overexpression lysate of glycerol kinase (GK), transcript variant 1 |
CNY 3,080.00 |
|
LY424888 | Transient overexpression lysate of glycerol kinase (GK), transcript variant 2 |
CNY 3,080.00 |
|
PH307264 | GK MS Standard C13 and N15-labeled recombinant protein (NP_976325) |
CNY 19,520.00 |
|
PH313688 | GK MS Standard C13 and N15-labeled recombinant protein (NP_000158) |
CNY 19,520.00 |
|
TP307264 | Recombinant protein of human glycerol kinase (GK), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Glycerol kinase产品