ARMETL1 (CDNF) (NM_001029954) Human Recombinant Protein
CAT#: TP313572
Recombinant protein of human arginine-rich, mutated in early stage tumors-like 1 (ARMETL1), 20 µg
View other "ARMETL1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213572 protein sequence
Red=Cloning site Green=Tags(s) MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISF CLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLR KMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001025125 |
Locus ID | 441549 |
UniProt ID | Q49AH0 |
Refseq Size | 1330 |
Cytogenetics | 10p13 |
Refseq ORF | 561 |
Synonyms | ARMETL1 |
Summary | Trophic factor for dopamine neurons. Prevents the 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422270 | CDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422270 | Transient overexpression lysate of cerebral dopamine neurotrophic factor (CDNF) |
CNY 3,080.00 |
|
PH313572 | CDNF MS Standard C13 and N15-labeled recombinant protein (NP_001025125) |
CNY 19,520.00 |
|
TP720771 | Purified recombinant protein of Human cerebral dopamine neurotrophic factor (CDNF) |
CNY 3,140.00 |
其它ARMETL1产品