KCNQ4 (NM_172163) Human Recombinant Protein
CAT#: TP313421
Recombinant protein of human potassium voltage-gated channel, KQT-like subfamily, member 4 (KCNQ4), transcript variant 2, 20 µg
View other "KCNQ4" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213421 representing NM_172163
Red=Cloning site Green=Tags(s) MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPGPGSGSGSACG QRSSAAHKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLSTIQEHQELANECLLILEFVMI VVFGLEYIVRVWSAGCCCRYRGWQGRFRFARKPFCVIDFIVFVASVAVIAAGTQGNIFATSALRSMRFLQ ILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTIT LTTIGYGDKTPHTWLGRVLAAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAW RLYSTDMSRAYLTATWYYYDSILPSFSSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEAT SPTKVQKSWSFNDRTRFRASLRLKPRTSAEDAPSEEVAEEKSYQCELTVDDIMPAVKTVIRSIRILKFLV AKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQTRVDQIVGRGPGDRKAREKGDKGPSDAEVVDEIS MMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTL SISRSVSTNMD TRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 71 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_751895 |
Locus ID | 9132 |
UniProt ID | P56696 |
Refseq Size | 2173 |
Cytogenetics | 1p34.2 |
Refseq ORF | 1923 |
Synonyms | DFNA2; DFNA2A; KV7.4 |
Summary | The protein encoded by this gene forms a potassium channel that is thought to play a critical role in the regulation of neuronal excitability, particularly in sensory cells of the cochlea. The current generated by this channel is inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. The encoded protein can form a homomultimeric potassium channel or possibly a heteromultimeric channel in association with the protein encoded by the KCNQ3 gene. Defects in this gene are a cause of nonsyndromic sensorineural deafness type 2 (DFNA2), an autosomal dominant form of progressive hearing loss. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406774 | KCNQ4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC417828 | KCNQ4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY406774 | Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 4 (KCNQ4), transcript variant 2 |
CNY 4,840.00 |
|
LY417828 | Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 4 (KCNQ4), transcript variant 1 |
CNY 4,840.00 |
|
PH313421 | KCNQ4 MS Standard C13 and N15-labeled recombinant protein (NP_751895) |
CNY 14,250.00 |