CTSA (NM_000308) Human Recombinant Protein
CAT#: TP313409
Recombinant protein of human cathepsin A (CTSA), transcript variant 1, 20 µg
View other "CTSA" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213409 representing NM_000308
Red=Cloning site Green=Tags(s) MTSSPRAPPGEQGRGGAEMIRAAPPPLFLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGY LKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANV LYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQ DPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEV ARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTN TTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMAC NFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSR FLNKQPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000299 |
Locus ID | 5476 |
UniProt ID | P10619 |
Refseq Size | 2254 |
Cytogenetics | 20q13.12 |
Refseq ORF | 1491 |
Synonyms | GLB2; GSL; NGBE; PPCA; PPGB |
Summary | This gene encodes a member of the peptidase S10 family of serine carboxypeptidases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate two chains that comprise the heterodimeric active enzyme. This enzyme possesses deamidase, esterase and carboxypeptidase activities and acts as a scaffold in the lysosomal multienzyme complex. Mutations in this gene are associated with galactosialidosis. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Renin-angiotensin system |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424807 | CTSA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC433152 | CTSA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY424807 | Transient overexpression lysate of cathepsin A (CTSA), transcript variant 1 |
CN¥ 4,840.00 |
|
LY433152 | Transient overexpression lysate of cathepsin A (CTSA), transcript variant 3 |
CN¥ 3,080.00 |
|
PH313409 | CTSA MS Standard C13 and N15-labeled recombinant protein (NP_000299) |
CN¥ 19,520.00 |
|
TP721221 | Purified recombinant protein of Human cathepsin A (CTSA), transcript variant 1 |
CN¥ 1,800.00 |