United States
Germany
Japan
United Kingdom
China
C2orf88 (NM_032321) Human Recombinant Protein
CAT＃: TP313211
Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 4, 20 µg
View other "C2orf88" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213211 representing NM_032321
Red=Cloning site Green=Tags(s) MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDIL CDALQQWACNNIKYHDIPYIESEGP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_115697 |
| Locus ID | 84281 |
| UniProt ID | Q9BSF0 |
| Refseq Size | 705 |
| Cytogenetics | 2q32.2 |
| Refseq ORF | 285 |
| Synonyms | smAKAP |
| Summary | Binds to type I regulatory subunits of protein kinase A (PKA-RI) and may anchor/target them to the plasma membrane.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403155 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420957 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420958 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420959 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403155 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 4 |
CNY 3,080.00 |
|
| LY420957 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 1 |
CNY 3,080.00 |
|
| LY420958 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 3 |
CNY 3,080.00 |
|
| LY420959 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 2 |
CNY 3,080.00 |
|
| PH302987 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035984) |
CNY 19,520.00 |
|
| PH313211 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_115697) |
CNY 19,520.00 |
|
| PH313362 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035985) |
CNY 14,250.00 |
|
| PH324360 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035986) |
CNY 14,250.00 |
|
| TP302987 | Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP313362 | Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP324360 | Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它C2orf88产品
