C8orf42 (TDRP) (NM_175075) Human Recombinant Protein

CAT#: TP313199

Recombinant protein of human chromosome 8 open reading frame 42 (C8orf42), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "C8orf42" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00

CNY 6,650.00


货期*
4周

规格
    • 20 ug

Cited in 2 publications.

Product images

经常一起买 (2)
Rabbit Polyclonal Anti-TDRP Antibody
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC213199 representing NM_175075
Red=Cloning site Green=Tags(s)

MVWGRAGSWGRVWGGFGGEGAGLVLGVPRPRLSPARPTGPASRRSRRQSVRRPGGTRSHSPTHGRRDAGA
RLTMWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSP
KSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWE
DDAKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_778250
Locus ID 157695
UniProt ID Q86YL5
Refseq Size 1901
Cytogenetics 8p23.3
Refseq ORF 774
Synonyms C8orf42; Inm01; TDRP1; TDRP2
Summary Contributes to normal sperm motility, but not essential for male fertility.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)

Documents

Other Versions

Customer Reviews 
Loading...