Parathyroid hormone related protein (PTHLH) (NM_198966) Human Recombinant Protein
CAT#: TP312744
Recombinant protein of human parathyroid hormone-like hormone (PTHLH), transcript variant 4, 20 µg
View other "Parathyroid hormone related protein" proteins (14)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212744 representing NM_198966
Red=Cloning site Green=Tags(s) MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_945317 |
Locus ID | 5744 |
UniProt ID | P12272, A0A024RB29 |
Refseq Size | 1312 |
Cytogenetics | 12p11.22 |
Refseq ORF | 531 |
Synonyms | BDE2; HHM; PLP; PTHR; PTHRP |
Summary | The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone. [provided by RefSeq, Nov 2013] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401000 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404641 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404642 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404643 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430780 | PTHLH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401000 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 2 |
CNY 3,080.00 |
|
LY404641 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 3 |
CNY 3,080.00 |
|
LY404642 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 1 |
CNY 3,080.00 |
|
LY404643 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 4 |
CNY 3,080.00 |
|
LY430780 | Transient overexpression lysate of parathyroid hormone-like hormone (PTHLH), transcript variant 4 |
CNY 3,080.00 |
|
PH312744 | PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_945317) |
CNY 19,520.00 |
|
PH312858 | PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_002811) |
CNY 19,520.00 |
|
TP312858 | Recombinant protein of human parathyroid hormone-like hormone (PTHLH), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760737 | Purified recombinant protein of Human parathyroid hormone-like hormone (PTHLH), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它Parathyroid hormone related protein产品