GMPPA (NM_205847) Human Recombinant Protein
CAT#: TP312726
Recombinant protein of human GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2, 20 µg
View other "GMPPA" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212726 protein sequence
Red=Cloning site Green=Tags(s) MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTQFLE AAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLL GTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDS PGLWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQIKSAGSALYASRLYLSRYQDTHPERLAKHTPGG PWIRGNVYIHPTAKVAPSAVLGPNVSIGKGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRW ARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_995319 |
Locus ID | 29926 |
UniProt ID | Q96IJ6 |
Refseq Size | 1845 |
Cytogenetics | 2q35 |
Refseq ORF | 1260 |
Synonyms | AAMR |
Summary | This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. [provided by RefSeq, Jul 2008] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403717 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC415641 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429378 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403717 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2 |
CNY 4,840.00 |
|
LY415641 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 1 |
CNY 3,080.00 |
|
LY429378 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 1 |
CNY 3,080.00 |
|
PH312726 | GMPPA MS Standard C13 and N15-labeled recombinant protein (NP_995319) |
CNY 19,520.00 |