MTH1 (NUDT1) (NM_198949) Human Recombinant Protein
CAT#: TP312705
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2B, 20 µg
View other "MTH1" proteins (24)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212705 protein sequence
Red=Cloning site Green=Tags(s) MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIED GARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMW PDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_945187 |
Locus ID | 4521 |
UniProt ID | P36639, A0A024R858 |
Refseq Size | 816 |
Cytogenetics | 7p22.3 |
Refseq ORF | 537 |
Synonyms | MTH1 |
Summary | Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A rare single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. [provided by RefSeq, Dec 2018] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404632 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404633 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404634 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404636 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404637 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419314 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429104 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404632 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2A |
CNY 3,080.00 |
|
LY404633 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2B |
CNY 3,080.00 |
|
LY404634 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3A |
CNY 3,080.00 |
|
LY404636 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4A |
CNY 3,080.00 |
|
LY404637 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4B |
CNY 3,080.00 |
|
LY419314 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 1 |
CNY 3,080.00 |
|
PH301148 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945190) |
CNY 19,520.00 |
|
PH308551 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_002443) |
CNY 14,250.00 |
|
PH312655 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945186) |
CNY 19,520.00 |
|
PH312705 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945187) |
CNY 19,520.00 |
|
PH312761 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945188) |
CNY 14,250.00 |
|
PH312808 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945191) |
CNY 14,250.00 |
|
TP301148 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3B, 20 µg |
CNY 2,900.00 |
|
TP308551 | Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312655 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2A, 20 µg |
CNY 2,900.00 |
|
TP312761 | Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3A, 20 µg |
CNY 2,900.00 |
|
TP312808 | Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4A, 20 µg |
CNY 2,900.00 |