PDLIM7 (NM_203352) Human Recombinant Protein
CAT#: TP312656
Recombinant protein of human PDZ and LIM domain 7 (enigma) (PDLIM7), transcript variant 2, 20 µg
View other "PDLIM7" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212656 representing NM_203352
Red=Cloning site Green=Tags(s) MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKI RACGERLSLGLSRAQPVQSKPQKVQTPDKQPLRPLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLT GTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLT RHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTPVCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKV LEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFYMEEG VPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAF SHV SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 46.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_976227 |
Locus ID | 9260 |
UniProt ID | Q9NR12 |
Refseq Size | 1607 |
Cytogenetics | 5q35.3 |
Refseq ORF | 1269 |
Synonyms | LMP1; LMP3 |
Summary | The protein encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament-associated complex essential for transmission of ret/ptc2 mitogenic signaling. The biological function is likely to be that of an adapter, with the PDZ domain localizing the LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404299 | PDLIM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC417291 | PDLIM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404299 | Transient overexpression lysate of PDZ and LIM domain 7 (enigma) (PDLIM7), transcript variant 2 |
CNY 4,840.00 |
|
LY417291 | Transient overexpression lysate of PDZ and LIM domain 7 (enigma) (PDLIM7), transcript variant 1 |
CNY 3,080.00 |
|
PH301005 | PDLIM7 MS Standard C13 and N15-labeled recombinant protein (NP_005442) |
CNY 14,250.00 |
|
PH312656 | PDLIM7 MS Standard C13 and N15-labeled recombinant protein (NP_976227) |
CNY 19,520.00 |
|
TP301005 | Recombinant protein of human PDZ and LIM domain 7 (enigma) (PDLIM7), transcript variant 1, 20 µg |
CNY 2,900.00 |