PDLIM7 (NM_203352) Human Mass Spec Standard
CAT#: PH312656
PDLIM7 MS Standard C13 and N15-labeled recombinant protein (NP_976227)
View other "PDLIM7" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PDLIM7 MS Standard C13 and N15-labeled recombinant protein (NP_976227) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212656 |
Predicted MW | 46.3 kDa |
Protein Sequence |
>RC212656 representing NM_203352
Red=Cloning site Green=Tags(s) MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKI RACGERLSLGLSRAQPVQSKPQKVQTPDKQPLRPLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLT GTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLT RHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTPVCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKV LEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFYMEEG VPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAF SHV SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_976227 |
RefSeq Size | 1607 |
RefSeq ORF | 1269 |
Synonyms | LMP1; LMP3 |
Locus ID | 9260 |
Cytogenetics | 5q35.3 |
Summary | The protein encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament-associated complex essential for transmission of ret/ptc2 mitogenic signaling. The biological function is likely to be that of an adapter, with the PDZ domain localizing the LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404299 | PDLIM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC417291 | PDLIM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404299 | Transient overexpression lysate of PDZ and LIM domain 7 (enigma) (PDLIM7), transcript variant 2 |
CNY 4,840.00 |
|
LY417291 | Transient overexpression lysate of PDZ and LIM domain 7 (enigma) (PDLIM7), transcript variant 1 |
CNY 3,080.00 |
|
PH301005 | PDLIM7 MS Standard C13 and N15-labeled recombinant protein (NP_005442) |
CNY 14,250.00 |
|
TP301005 | Recombinant protein of human PDZ and LIM domain 7 (enigma) (PDLIM7), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312656 | Recombinant protein of human PDZ and LIM domain 7 (enigma) (PDLIM7), transcript variant 2, 20 µg |
CNY 2,900.00 |