FIGLA (NM_001004311) Human Recombinant Protein
CAT#: TP312562
Recombinant protein of human folliculogenesis specific basic helix-loop-helix (FIGLA), 20 µg
View other "FIGLA" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212562 representing NM_001004311
Red=Cloning site Green=Tags(s) MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENLQLVLERRRVA NAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDLLEGAKDSKKQDPDEQSYSNN SSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSGEPAHACRHSVMSTTEIISPTRSLDRFPEVE LLSHRLPQV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001004311 |
Locus ID | 344018 |
UniProt ID | Q6QHK4 |
Refseq Size | 724 |
Cytogenetics | 2p13.3 |
Refseq ORF | 657 |
Synonyms | BHLHC8; FIGALPHA; POF6 |
Summary | This gene encodes a protein that functions in postnatal oocyte-specific gene expression. The protein is a basic helix-loop-helix transcription factor that regulates multiple oocyte-specific genes, including genes involved in folliculogenesis and those that encode the zona pellucida. Mutations in this gene cause premature ovarian failure type 6. [provided by RefSeq, Sep 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424087 | FIGLA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY424087 | Transient overexpression lysate of folliculogenesis specific basic helix-loop-helix (FIGLA) |
CN¥ 3,080.00 |
|
PH312562 | FIGLA MS Standard C13 and N15-labeled recombinant protein (NP_001004311) |
CN¥ 19,520.00 |