Myosin (MYL5) (NM_002477) Human Recombinant Protein
CAT#: TP312414
Recombinant protein of human myosin, light chain 5, regulatory (MYL5), 20 µg
View other "Myosin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212414 representing NM_002477
Red=Cloning site Green=Tags(s) MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDD ELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEE VDQMFQFASIDVAGNLDYKALSYVITHGEEKEE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002468 |
Locus ID | 4636 |
UniProt ID | Q02045 |
Refseq Size | 661 |
Cytogenetics | 4p16.3 |
Refseq ORF | 519 |
Synonyms | MYLC2 |
Summary | This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq, Jul 2008] |
Protein Pathways | Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419312 | MYL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419312 | Transient overexpression lysate of myosin, light chain 5, regulatory (MYL5) |
CNY 3,080.00 |
|
PH312414 | MYL5 MS Standard C13 and N15-labeled recombinant protein (NP_002468) |
CNY 19,520.00 |