United States
Germany
Japan
United Kingdom
China
MRAS (NM_012219) Human Recombinant Protein
CAT＃: TP312259
Recombinant protein of human muscle RAS oncogene homolog (MRAS), transcript variant 1, 20 µg
View other "MRAS" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212259 representing NM_012219
Red=Cloning site Green=Tags(s) MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAG QEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQ GKEMATKHNTPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036351 |
| Locus ID | 22808 |
| UniProt ID | O14807 |
| Refseq Size | 3926 |
| Cytogenetics | 3q22.3 |
| Refseq ORF | 624 |
| Synonyms | M-RAs; NS11; R-RAS3; RRAS3 |
| Summary | This gene encodes a member of the Ras family of small GTPases. These membrane-associated proteins function as signal transducers in multiple processes including cell growth and differentiation, and dysregulation of Ras signaling has been associated with many types of cancer. The encoded protein may play a role in the tumor necrosis factor-alpha and MAP kinase signaling pathways. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415896 | MRAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421269 | MRAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415896 | Transient overexpression lysate of muscle RAS oncogene homolog (MRAS), transcript variant 1 |
CNY 3,080.00 |
|
| LY421269 | Transient overexpression lysate of muscle RAS oncogene homolog (MRAS), transcript variant 2 |
CNY 3,080.00 |
|
| PH312259 | MRAS MS Standard C13 and N15-labeled recombinant protein (NP_036351) |
CNY 19,520.00 |
|
| PH318272 | MRAS MS Standard C13 and N15-labeled recombinant protein (NP_001078518) |
CNY 19,520.00 |
|
| TP318272 | Recombinant protein of human muscle RAS oncogene homolog (MRAS), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP760665 | Purified recombinant protein of Human muscle RAS oncogene homolog (MRAS), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
