CEACAM7 (NM_006890) Human Recombinant Protein
CAT#: TP312214
Purified recombinant protein of Homo sapiens carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7), 20 µg
View other "CEACAM7" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212214 representing NM_006890
Red=Cloning site Green=Tags(s) MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKG ERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFY VFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKND IGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008821 |
Locus ID | 1087 |
UniProt ID | Q14002 |
Refseq Size | 2292 |
Cytogenetics | 19q13.2 |
Refseq ORF | 795 |
Synonyms | CGM2 |
Summary | This gene encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Additionally, lower expression levels of this gene may be predictive of rectal cancer recurrence. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402055 | CEACAM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402055 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7) |
CNY 3,080.00 |
|
PH312214 | CEACAM7 MS Standard C13 and N15-labeled recombinant protein (NP_008821) |
CNY 14,250.00 |
其它CEACAM7产品