Adducin 2 (ADD2) (NM_017482) Human Recombinant Protein
CAT#: TP312102
Recombinant protein of human adducin 2 (beta) (ADD2), transcript variant beta-2, 20 µg
View other "Adducin 2" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212102 representing NM_017482
Red=Cloning site Green=Tags(s) MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGL IQEQMKKGNNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSV YRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFC LHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGP TCKILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQVSALSSAGGVENLILLEQEKHRPHEVGSVQWAGS TFGPMQKSRLGEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEIPATVTAFVFEEDGAPVPALR QHAQKQQKEKTRWLNTPNTYLRVNVADEVQRSMGSPRPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYT DPQEVLEMRNKIREQNRQDVKSAGPQSQLLASVIAEKSRSPVEQRLPLTGGETCLPCLRGLVPGAGLQDP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 62.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_059516 |
Locus ID | 119 |
UniProt ID | P35612 |
Refseq Size | 2775 |
Cytogenetics | 2p13.3 |
Refseq ORF | 1680 |
Synonyms | ADDB |
Summary | Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jun 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413766 | ADD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC413769 | ADD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC419845 | ADD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY413766 | Transient overexpression lysate of adducin 2 (beta) (ADD2), transcript variant beta-2 |
CN¥ 4,840.00 |
|
LY413769 | Transient overexpression lysate of adducin 2 (beta) (ADD2), transcript variant beta-4 |
CN¥ 3,080.00 |
|
LY419845 | Transient overexpression lysate of adducin 2 (beta) (ADD2), transcript variant beta-1 |
CN¥ 3,080.00 |
|
PH307895 | ADD2 MS Standard C13 and N15-labeled recombinant protein (NP_059522) |
CN¥ 19,520.00 |
|
PH309517 | ADD2 MS Standard C13 and N15-labeled recombinant protein (NP_001608) |
CN¥ 19,520.00 |
|
PH312102 | ADD2 MS Standard C13 and N15-labeled recombinant protein (NP_059516) |
CN¥ 19,520.00 |
|
TP307895 | Recombinant protein of human adducin 2 (beta) (ADD2), transcript variant beta-4, 20 µg |
CN¥ 2,900.00 |
|
TP309517 | Recombinant protein of human adducin 2 (beta) (ADD2), transcript variant beta-1, 20 µg |
CN¥ 2,900.00 |
其它Adducin 2产品