SKIP (INPP5K) (NM_130766) Human Recombinant Protein
CAT#: TP312090
Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, 20 µg
View other "SKIP" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212090 protein sequence
Red=Cloning site Green=Tags(s) MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR SVVGISRPFQIPPGSLREDPLGEAQPQI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_570122 |
Locus ID | 51763 |
UniProt ID | Q9BT40 |
Refseq Size | 3232 |
Cytogenetics | 17p13.3 |
Refseq ORF | 1347 |
Synonyms | MDCCAID; PPS; SKIP |
Summary | This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Inositol phosphate metabolism, Insulin signaling pathway, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402561 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408929 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427643 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402561 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1 |
CNY 3,080.00 |
|
LY408929 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2 |
CNY 3,080.00 |
|
LY427643 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3 |
CNY 3,080.00 |
|
PH300092 | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_057616) |
CNY 19,520.00 |
|
PH312090 | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_570122) |
CNY 19,520.00 |
|
PH327852 | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_001129114) |
CNY 19,520.00 |
|
TP300092 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP327852 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3, 20 µg |
CNY 2,900.00 |