United States
Germany
Japan
United Kingdom
China
DISC1 (NM_018662) Human Recombinant Protein
CAT＃: TP312015
Recombinant protein of human disrupted in schizophrenia 1 (DISC1), transcript variant L, 20 µg
View other "DISC1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
| Cited in 2 publications. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212015 representing NM_018662
Red=Cloning site Green=Tags(s) MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGG VSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGIQLRGGTRLPDRLSWPCGPGS AGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSAELSSNSCSPGCGPEVPPTPPGSHSAFTSSF SFIRLSLGSAGERGEAEGCPPSREAESHCQSPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQA ARNSSRPERDMHSLPDMDPGSSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEV ISLRLKLQKLQEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGA TQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLEAKDQQLRREI EEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEI TTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNHFWTAKDLTEEIRSLTSEREGLEGLLSKLLV LSSRNVKKLGSVKEDYNRLRREVEHQETAYETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRL LIQSLQLQEARGSLSVEDERQMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEE SYILSAELGEKCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREA AASCMTAGVHEAQA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 93.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | ELISA binding assay (PMID: 26062786) |
| Reference Data | |
| RefSeq | NP_061132 |
| Locus ID | 27185 |
| UniProt ID | Q9NRI5 |
| Refseq Size | 7069 |
| Cytogenetics | 1q42.2 |
| Refseq ORF | 2562 |
| Synonyms | C1orf136; SCZD9 |
| Summary | This gene encodes a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins. This gene is disrupted in a t(1;11)(q42.1;q14.3) translocation which segregates with schizophrenia and related psychiatric disorders in a large Scottish family. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Stimulation of Synaptic Vesicle Exocytosis by the Mental Disease Gene DISC1 is Mediated by N-Type Voltage-Gated Calcium Channels
,null,
Frontiers in Synaptic Neuroscience
,PubMed ID 27378904
[DISC1]
|
|
Disrupted-in-Schizophrenia-1 Attenuates Amyloid-ß Generation and Cognitive Deficits in APP/PS1 Transgenic Mice by Reduction of ß-Site APP-Cleaving Enzyme 1 Levels
,Deng, QS;Dong, XY;Wu, H;Wang, W;Wang, ZT;Zhu, JW;Liu, CF;Jia, WQ;Zhang, Y;Schachner, M;Ma, QH;Xu, RX;,
Neuropsychopharmacology
,PubMed ID 26062786
[DISC1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402701 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC431332 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431372 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431469 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431473 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431560 | DISC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY402701 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant L |
CNY 4,840.00 |
|
| LY431332 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant q |
CNY 3,080.00 |
|
| LY431372 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant m |
CNY 3,080.00 |
|
| LY431469 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant l |
CNY 3,080.00 |
|
| LY431473 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant k |
CNY 3,080.00 |
|
| LY431560 | Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant f |
CNY 4,840.00 |
|
| PH312015 | DISC1 MS Standard C13 and N15-labeled recombinant protein (NP_061132) |
CNY 19,520.00 |
