SIL1 (NM_022464) Human Recombinant Protein
CAT#: TP311850
Recombinant protein of human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2, 20 µg
View other "SIL1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211850 representing NM_022464
Red=Cloning site Green=Tags(s) MAPQSLPSSRMAPLGMLLGLLMAACFTFCLSHQNLKEFALTNPEKSSTKETERKETKAEEELDAEVLEVF HPTHEWQALQPGQAVPAGSHVRLNLQTGEREAKLQYEDKFRNNLKGKRLDINTNTYTSQDLKSALAKFKE GAEMESSKEDKARQAEVKRLFRPIEELKKDFDELNVVIETDMQIMVRLINKFNSSSSSLEEKIAALFDLE YYVHQMDNAQDLLSFGGLQVVINGLNSTEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATE QPLTAKKKVLFALCSLLRHFPYAQRQFLKLGGLQVLRTLVQEKGTEVLAVRVVTLLYDLVTEKMFAEEEA ELTQEMSPEKLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCRDRYRQDPQLGR TLASLQAEYQVLASLELQDGEDEGYFQELLGSVNSLLKELR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071909 |
Locus ID | 64374 |
UniProt ID | Q9H173 |
Refseq Size | 1815 |
Cytogenetics | 5q31.2 |
Refseq ORF | 1383 |
Synonyms | BAP; MSS; ULG5 |
Summary | This gene encodes a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in this gene have been associated with Marinesco-Sjogren syndrome. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Protease, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402924 | SIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421971 | SIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402924 | Transient overexpression lysate of SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 2 |
CNY 3,080.00 |
|
LY421971 | Transient overexpression lysate of SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1 |
CNY 3,080.00 |
|
PH304204 | SIL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032722) |
CNY 19,520.00 |
|
PH311850 | SIL1 MS Standard C13 and N15-labeled recombinant protein (NP_071909) |
CNY 19,520.00 |
|
TP304204 | Recombinant protein of human SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae) (SIL1), transcript variant 1, 20 µg |
CNY 2,900.00 |