Rho GTPase activating protein 24 (ARHGAP24) (NM_001025616) Human Recombinant Protein
CAT#: TP311832
Recombinant protein of human Rho GTPase activating protein 24 (ARHGAP24), transcript variant 1, 20 µg
View other "Rho GTPase activating protein 24" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211832 representing NM_001025616
Red=Cloning site Green=Tags(s) MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNKV SEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDT VRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASL LKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGV NKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQ KKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMV KKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSD TLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSC EISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNS ETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIK MRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 84.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001020787 |
Locus ID | 83478 |
UniProt ID | Q8N264 |
Refseq Size | 2936 |
Cytogenetics | 4q21.23-q21.3 |
Refseq ORF | 2244 |
Synonyms | FILGAP; p73; p73RhoGAP; RC-GAP72; RCGAP72 |
Summary | This gene encodes a Rho-GTPase activating protein, which is specific for the small GTPase family member Rac. Binding of the encoded protein by filamin A targets it to sites of membrane protrusion, where it antognizes Rac. This results in suppression of lamellae formation and promotion of retraction to regulate cell polarity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410555 | ARHGAP24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421018 | ARHGAP24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422457 | ARHGAP24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY410555 | Transient overexpression lysate of Rho GTPase activating protein 24 (ARHGAP24), transcript variant 2 |
CNY 4,840.00 |
|
LY421018 | Transient overexpression lysate of Rho GTPase activating protein 24 (ARHGAP24), transcript variant 3 |
CNY 4,840.00 |
|
LY422457 | Transient overexpression lysate of Rho GTPase activating protein 24 (ARHGAP24), transcript variant 1 |
CNY 4,840.00 |
|
PH311832 | ARHGAP24 MS Standard C13 and N15-labeled recombinant protein (NP_001020787) |
CNY 14,250.00 |
|
TP761097 | Purified recombinant protein of Human Rho GTPase activating protein 24 (ARHGAP24), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Rho GTPase activating protein 24产品