CLEC10A (NM_006344) Human Recombinant Protein
CAT#: TP311598
Recombinant protein of human C-type lectin domain family 10, member A (CLEC10A), transcript variant 2, 20 µg
View other "CLEC10A" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211598 representing NM_006344
Red=Cloning site Green=Tags(s) MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLV TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQV ATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGS AYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVC EAGLGQTSQESH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006335 |
Locus ID | 10462 |
UniProt ID | Q8IUN9 |
Refseq Size | 1716 |
Cytogenetics | 17p13.1 |
Refseq ORF | 876 |
Synonyms | CD301; CLECSF13; CLECSF14; HML; HML2; MGL |
Summary | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405320 | CLEC10A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416712 | CLEC10A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405320 | Transient overexpression lysate of C-type lectin domain family 10, member A (CLEC10A), transcript variant 1 |
CNY 3,080.00 |
|
LY416712 | Transient overexpression lysate of C-type lectin domain family 10, member A (CLEC10A), transcript variant 2 |
CNY 3,080.00 |
|
PH311598 | CLEC10A MS Standard C13 and N15-labeled recombinant protein (NP_006335) |
CNY 19,520.00 |
|
TP720473 | Recombinant protein of human C-type lectin domain family 10, member A (CLEC10A), transcript variant 2 |
CNY 4,060.00 |
其它CLEC10A产品