CD153 (TNFSF8) (NM_001244) Human Recombinant Protein
CAT#: TP311276
Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8), 20 µg
View other "CD153" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211276 protein sequence
Red=Cloning site Green=Tags(s) MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPN SPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYF IICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDT FQYIDTSTFPLENVLSIFLYSNSD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001235 |
Locus ID | 944 |
UniProt ID | P32971, Q52M88 |
Refseq Size | 3797 |
Cytogenetics | 9q32-q33.1 |
Refseq ORF | 702 |
Synonyms | CD30L; CD30LG; CD153; TNLG3A |
Summary | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420051 | TNFSF8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420051 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8) |
CNY 3,080.00 |
|
PH311276 | TNFSF8 MS Standard C13 and N15-labeled recombinant protein (NP_001235) |
CNY 19,520.00 |
|
TP723961 | Human CD30 Ligand Protein, mFc-His Tag |
CNY 5,249.00 |