CPLX2 (NM_006650) Human Recombinant Protein
CAT#: TP310806
Recombinant protein of human complexin 2 (CPLX2), transcript variant 1, 20 µg
View other "CPLX2" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210806 protein sequence
Red=Cloning site Green=Tags(s) MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKY GLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006641 |
Locus ID | 10814 |
UniProt ID | Q6PUV4 |
Refseq Size | 4726 |
Cytogenetics | 5q35.2 |
Refseq ORF | 402 |
Synonyms | 921-L; CPX-2; CPX2; Hfb1 |
Summary | Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416505 | CPLX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423397 | CPLX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416505 | Transient overexpression lysate of complexin 2 (CPLX2), transcript variant 1 |
CNY 3,080.00 |
|
LY423397 | Transient overexpression lysate of complexin 2 (CPLX2), transcript variant 2 |
CNY 3,080.00 |
|
PH310806 | CPLX2 MS Standard C13 and N15-labeled recombinant protein (NP_006641) |
CNY 19,520.00 |
|
PH321947 | CPLX2 MS Standard C13 and N15-labeled recombinant protein (NP_001008221) |
CNY 19,520.00 |
|
TP321947 | Recombinant protein of human complexin 2 (CPLX2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP710112 | Recombinant protein of human human complexin 2 (CPLX2), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells |
CNY 4,020.00 |