SNX5 (NM_014426) Human Recombinant Protein
CAT#: TP310773
Recombinant protein of human sorting nexin 5 (SNX5), transcript variant 2, 20 µg
View other "SNX5" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210773 protein sequence
Red=Cloning site Green=Tags(s) MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHE DFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTV SSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFE QEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVE GRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKF EQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055241 |
Locus ID | 27131 |
UniProt ID | Q9Y5X3 |
Refseq Size | 2353 |
Cytogenetics | 20p11.23 |
Refseq ORF | 1212 |
Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein functions in endosomal sorting, the phosphoinositide-signaling pathway, and macropinocytosis. This gene may play a role in the tumorigenesis of papillary thyroid carcinoma. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402334 | SNX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407705 | SNX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402334 | Transient overexpression lysate of sorting nexin 5 (SNX5), transcript variant 2 |
CNY 3,080.00 |
|
LY407705 | Transient overexpression lysate of sorting nexin 5 (SNX5), transcript variant 1 |
CNY 3,080.00 |
|
PH310773 | SNX5 MS Standard C13 and N15-labeled recombinant protein (NP_055241) |
CNY 19,520.00 |
|
PH321829 | SNX5 MS Standard C13 and N15-labeled recombinant protein (NP_689413) |
CNY 19,520.00 |
|
TP321829 | Recombinant protein of human sorting nexin 5 (SNX5), transcript variant 1, 20 µg |
CNY 2,900.00 |