COX19 (NM_001031617) Human Recombinant Protein
CAT#: TP310770
Recombinant protein of human COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19), 20 µg
View other "COX19" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210770 protein sequence
Red=Cloning site Green=Tags(s) MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ EPLEKLGFGDLTSGKSEAKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001026788 |
Locus ID | 90639 |
UniProt ID | Q49B96 |
Refseq Size | 4896 |
Cytogenetics | 7p22.3 |
Refseq ORF | 270 |
Summary | COX19 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox19 protein may play a role in metal transport to the mitochondrial intermembrane space and assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422214 | COX19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422214 | Transient overexpression lysate of COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19) |
CNY 3,080.00 |
|
PH310770 | COX19 MS Standard C13 and N15-labeled recombinant protein (NP_001026788) |
CNY 19,520.00 |