HSF2 (NM_004506) Human Recombinant Protein
CAT#: TP310751
Recombinant protein of human heat shock transcription factor 2 (HSF2), transcript variant 1, 20 µg
View other "HSF2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210751 protein sequence
Red=Cloning site Green=Tags(s) MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGF RKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQ ETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKK NLFQHIVKEPTDNHHHKVPHSRTEGLKPRERISDDIIIYDVTDDNADEENIPVIPETNEDVISDPSNCSQ YPDIVIVEDDNEDEYAPVIQSGEQNEPARESLSSGSDGSSPLMSSAVQLNGSSSLTSEDPVTMMDSILND NINLLGKVELLDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDLFTSSVQMNPTDYINNTKSENKGLETTK NNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSS LDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004497 |
Locus ID | 3298 |
UniProt ID | Q03933 |
Refseq Size | 2697 |
Cytogenetics | 6q22.31 |
Refseq ORF | 1608 |
Synonyms | HSF 2; HSTF 2 |
Summary | The protein encoded by this gene belongs to the HSF family of transcription factors that bind specifically to the heat-shock promoter element and activate transcription. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401434 | HSF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401434 | Transient overexpression lysate of heat shock transcription factor 2 (HSF2), transcript variant 1 |
CNY 3,080.00 |
|
PH310751 | HSF2 MS Standard C13 and N15-labeled recombinant protein (NP_004497) |
CNY 19,520.00 |
|
TP720255 | Recombinant protein of human heat shock transcription factor 2 (HSF2), transcript variant 2 |
CNY 3,140.00 |