MAPRE1 (NM_012325) Human Recombinant Protein
CAT#: TP310749
Recombinant protein of human microtubule-associated protein, RP/EB family, member 1 (MAPRE1), 20 µg
View other "MAPRE1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210749 protein sequence
Red=Cloning site Green=Tags(s) MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHE YIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPS LVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDL EKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036457 |
Locus ID | 22919 |
UniProt ID | Q15691 |
Refseq Size | 2640 |
Cytogenetics | 20q11.21 |
Refseq ORF | 804 |
Synonyms | EB1 |
Summary | The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402208 | MAPRE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402208 | Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 1 (MAPRE1) |
CNY 3,080.00 |
|
PH310749 | MAPRE1 MS Standard C13 and N15-labeled recombinant protein (NP_036457) |
CNY 19,520.00 |
|
TP710361 | Purified recombinant protein of human microtubule-associated protein, RP/EB family, member 1 (MAPRE1), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |