ACMSD (NM_138326) Human Recombinant Protein
CAT#: TP310656
Recombinant protein of human aminocarboxymuconate semialdehyde decarboxylase (ACMSD), 20 µg
View other "ACMSD" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210656 protein sequence
Red=Cloning site Green=Tags(s) MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTV QALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPG VQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGG VFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDV IGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612199 |
Locus ID | 130013 |
UniProt ID | Q8TDX5 |
Refseq Size | 1278 |
Cytogenetics | 2q21.3 |
Refseq ORF | 1008 |
Summary | The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon-semialdehyde (ACMS). ACMSD (ACMS decarboxylase; EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS.[supplied by OMIM, Oct 2004] |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, Tryptophan metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408707 | ACMSD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408707 | Transient overexpression lysate of aminocarboxymuconate semialdehyde decarboxylase (ACMSD) |
CNY 3,080.00 |
|
PH310656 | ACMSD MS Standard C13 and N15-labeled recombinant protein (NP_612199) |
CNY 19,520.00 |