United States
Germany
Japan
United Kingdom
China
CUTA (NM_001014837) Human Recombinant Protein
CAT＃: TP310646
Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 3, 20 µg
View other "CUTA" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210646 protein sequence
Red=Cloning site Green=Tags(s) MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRL AACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQW VRQVTESVSDSITVLP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001014837 |
| Locus ID | 51596 |
| UniProt ID | O60888 |
| Refseq Size | 1072 |
| Cytogenetics | 6p21.32 |
| Refseq ORF | 468 |
| Synonyms | ACHAP; C6orf82 |
| Summary | May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414324 | CUTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423090 | CUTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423091 | CUTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414324 | Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 2 |
CNY 3,080.00 |
|
| LY423090 | Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 3 |
CNY 3,080.00 |
|
| LY423091 | Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 4 |
CNY 3,080.00 |
|
| PH300075 | CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014838) |
CNY 19,520.00 |
|
| PH310646 | CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014837) |
CNY 19,520.00 |
|
| PH319077 | CUTA MS Standard C13 and N15-labeled recombinant protein (NP_057005) |
CNY 19,520.00 |
|
| TP300075 | Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP319077 | Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720228 | Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 1 |
CNY 3,140.00 |
