ABHD2 (NM_152924) Human Recombinant Protein
CAT#: TP310637
Recombinant protein of human abhydrolase domain containing 2 (ABHD2), transcript variant 2, 20 µg
View other "ABHD2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210637 protein sequence
Red=Cloning site Green=Tags(s) MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPL IWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEK QYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGG NIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHV KKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHE SLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQV EADLE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_690888 |
Locus ID | 11057 |
UniProt ID | P08910 |
Refseq Size | 8761 |
Cytogenetics | 15q26.1 |
Refseq ORF | 1275 |
Synonyms | HS1-2; LABH2; PHPS1-2 |
Summary | This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq, Jan 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402075 | ABHD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC407219 | ABHD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402075 | Transient overexpression lysate of abhydrolase domain containing 2 (ABHD2), transcript variant 1 |
CN¥ 3,080.00 |
|
LY407219 | Transient overexpression lysate of abhydrolase domain containing 2 (ABHD2), transcript variant 2 |
CN¥ 3,080.00 |
|
PH305260 | ABHD2 MS Standard C13 and N15-labeled recombinant protein (NP_008942) |
CN¥ 19,520.00 |
|
PH310637 | ABHD2 MS Standard C13 and N15-labeled recombinant protein (NP_690888) |
CN¥ 19,520.00 |
|
TP305260 | Recombinant protein of human abhydrolase domain containing 2 (ABHD2), transcript variant 1, 20 µg |
CN¥ 2,900.00 |