INPP1 (NM_002194) Human Recombinant Protein
CAT#: TP310604
Recombinant protein of human inositol polyphosphate-1-phosphatase (INPP1), transcript variant 2, 20 µg
View other "INPP1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210604 protein sequence
Red=Cloning site Green=Tags(s) MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFP GLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTE INVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGVPLMGVINQPFVSRDP NTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAAFSPSFSAVISTSEKETIKAALSRVC GDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQ LVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002185 |
Locus ID | 3628 |
UniProt ID | P49441 |
Refseq Size | 2035 |
Cytogenetics | 2q32.2 |
Refseq ORF | 1197 |
Summary | This gene encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419477 | INPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427029 | INPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419477 | Transient overexpression lysate of inositol polyphosphate-1-phosphatase (INPP1), transcript variant 2 |
CNY 3,080.00 |
|
LY427029 | Transient overexpression lysate of inositol polyphosphate-1-phosphatase (INPP1), transcript variant 1 |
CNY 3,080.00 |
|
PH310604 | INPP1 MS Standard C13 and N15-labeled recombinant protein (NP_002185) |
CNY 19,520.00 |