Acyl coenzyme A Thioesterase 4 (ACOT4) (NM_152331) Human Recombinant Protein
CAT#: TP310550
Recombinant protein of human acyl-CoA thioesterase 4 (ACOT4), 20 µg
View other "Acyl coenzyme A Thioesterase 4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210550 representing NM_152331
Red=Cloning site Green=Tags(s) MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGELDLERAPALGG SFAGLEPMGLLWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLLCQAQHERHFLPPGVRRQSVR AGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAGHGFATLALAYYNFEDLPNNMDNISLEYFEE AVCYMLQHPQVKGPGIGLLGISLGADICLSMASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLR RIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKP QIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPK L myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689544 |
Locus ID | 122970 |
UniProt ID | Q8N9L9 |
Refseq Size | 1703 |
Cytogenetics | 14q24.3 |
Refseq ORF | 1263 |
Synonyms | PTE-Ib; PTE1B; PTE2B |
Summary | Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH (PubMed:16940157). ACOT4 is a peroxisomal succinyl-coenzyme A thioesterase can also hydrolyze glutaryl-CoA and long chain saturated acyl-CoAs (PubMed:16940157).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Biosynthesis of unsaturated fatty acids |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407636 | ACOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407636 | Transient overexpression lysate of acyl-CoA thioesterase 4 (ACOT4) |
CNY 3,080.00 |
|
PH310550 | ACOT4 MS Standard C13 and N15-labeled recombinant protein (NP_689544) |
CNY 19,520.00 |
其它Acyl coenzyme A Thioesterase 4产品