Alkaline Phosphatase (ALPP) (NM_001632) Human Recombinant Protein
CAT#: TP310504
Recombinant protein of human alkaline phosphatase, placental (Regan isozyme) (ALPP), 20 µg
View other "Alkaline Phosphatase" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210504 protein sequence
Red=Cloning site Green=Tags(s) MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVST VTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARF NQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIAT QLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASL DPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRAL TETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACL EPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001623 |
Locus ID | 250 |
UniProt ID | P05187 |
Refseq Size | 2883 |
Cytogenetics | 2q37.1 |
Refseq ORF | 1605 |
Synonyms | ALP; ALPI; IAP; PALP; PLAP; PLAP-1 |
Summary | The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells. [provided by RefSeq, Aug 2020] |
Protein Pathways | Folate biosynthesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419831 | ALPP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419831 | Transient overexpression lysate of alkaline phosphatase, placental (Regan isozyme) (ALPP) |
CNY 3,080.00 |
|
PH310504 | ALPP MS Standard C13 and N15-labeled recombinant protein (NP_001623) |
CNY 19,520.00 |
|
TP721056 | Purified recombinant protein of Human alkaline phosphatase, placental (ALPP) |
CNY 3,140.00 |
其它Alkaline Phosphatase产品