Bcl 7A (BCL7A) (NM_001024808) Human Recombinant Protein
CAT#: TP310489
Recombinant protein of human B-cell CLL/lymphoma 7A (BCL7A), transcript variant 2, 20 µg
View other "Bcl 7A" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210489 protein sequence
Red=Cloning site Green=Tags(s) MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEK CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGK EHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001019979 |
Locus ID | 605 |
UniProt ID | Q4VC05 |
Refseq Size | 3651 |
Cytogenetics | 12q24.31 |
Refseq ORF | 630 |
Synonyms | BCL7 |
Summary | This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422541 | BCL7A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422541 | Transient overexpression lysate of B-cell CLL/lymphoma 7A (BCL7A), transcript variant 2 |
CNY 3,080.00 |
|
PH310489 | BCL7A MS Standard C13 and N15-labeled recombinant protein (NP_001019979) |
CNY 19,520.00 |
|
TP761003 | Purified recombinant protein of Human B-cell CLL/lymphoma 7A (BCL7A), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2,040.00 |